PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT19784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 790aa    MW: 87459.1 Da    PI: 5.6115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT19784genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-1854100148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ +++ vk++G+  W+tIa+ ++ gR +kqc++rw+++l
         EMT19784  54 KGPWSKEEDDVIIQMVKKYGPTKWSTIAQALP-GRIGKQCRERWHNHL 100
                      79******************************.*************97 PP

2Myb_DNA-binding53.84.5e-17106148145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
         EMT19784 106 KDAWTQEEEIRLIQAHHIYGNK-WAELSKFLP-GRTDNAIKNHWH 148
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-132964IPR009057Homeodomain-like
PROSITE profilePS500904.2522948IPR017877Myb-like domain
PROSITE profilePS5129431.79349104IPR017930Myb domain
SuperFamilySSF466892.01E-3151147IPR009057Homeodomain-like
SMARTSM007172.8E-1753102IPR001005SANT/Myb domain
CDDcd001672.48E-1556100No hitNo description
PfamPF139211.9E-1857117No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2665108IPR009057Homeodomain-like
PROSITE profilePS5129420.671105155IPR017930Myb domain
SMARTSM007171.0E-15105153IPR001005SANT/Myb domain
CDDcd001672.31E-12108148No hitNo description
Gene3DG3DSA:1.10.10.602.6E-21109154IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MTTSSAHEPA APTTKAAALH PDTPETIKAE CFPDRTDVQC LHRWQKVLNP ELVKGPWSKE  60
EDDVIIQMVK KYGPTKWSTI AQALPGRIGK QCRERWHNHL NPGINKDAWT QEEEIRLIQA  120
HHIYGNKWAE LSKFLPGRTD NAIKNHWHSS VKKKYESYRA EGLLAQFQGL PAVVYPTGSL  180
NVDSSSAMTQ QNSDGSGLNV NQEVQDSSEF SQSALANISS SQVEQVDEPV GCHGQIHSSD  240
GAHDSYSSCQ EACDTKANDA ASTSPETRHQ LSISENDPDI HWQQDLSVAD FDLQSELWQD  300
ISYQSLLTAP DSISADSFFS PNYPHSACSS EVANNFEEPL YPLHTYSSSR TGTVHHQSSA  360
TSVPPSFICS GRASQIVSSE LPIVPESKEQ QLTSVEESQP LESTTMGREG SPNHGKSVVG  420
QKQHSEALCY EPPCFPSLEV PFVSCELISS SDLPEYSPLG IRQLMRPSMS FSTPLRLWSS  480
PTCDRSRDDV LKSAAKSSVC TPSIMKKRQR EPPSPIPDVR LAKKMGTEKD CGSSAMPSTR  540
TERSCRDATR DDSLDLIPEN SKDIIYQGKT EDNANINTLE KGERCSTTER DTAYNLVSAG  600
ILTDRNGPNP ERRKLNTPTK SFSKDIISSR SKPTELLVEK SSVYINADYE YVNILADTPG  660
IKRGLESPSA WKSPLFTNFQ DGFFMSPTGT TFDALGLVKQ INEQNAPALE EAHELLESGS  720
LCNKESSDKE NIKHIVIKKE HATTNQISNV MSEARILDFN ECTTPVKKKE DNRCNTLGRS  780
PTSYVLKNVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-582915433158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-582915433158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519200.0JF951920.1 Triticum aestivum clone TaMYB35 R1R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231586.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231588.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231587.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLR7WG840.0R7WG84_AEGTA; Myb-related protein 3R-1
STRINGMLOC_67317.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.25e-81myb domain protein 3r-4